You must be logged in to post a review.
FOXO4
Strength: 10mg
CAS: 2460055-10-9
Chemical Formula: C₂₂₈H₃₈₈N₈₆O₆₄
Molecular weight: 5358.05 g/mol
Peptide Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
Synonyms: FOXO4-DRI
Storage: Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.
Shelf life: 24 months from the manufacturing date.
FOXO4 is a synthetic peptide studied for its role in cellular senescence and aging-related signaling pathways. Research suggests that it may influence the regulation of senescent cell survival and stress-response mechanisms, primarily through modulation of FOXO transcription factor signaling involved in apoptosis, DNA repair, and cellular homeostasis.
Disclaimer : Available as lyophilized (freeze-dried) powder for laboratory and in vitro research applications. Reconstitution solution is not included in the pack.
Purity ≥99%
Made in USA
Research Use Only
Fast Shipping
Explore Other High-Purity Peptides
SS-31 10mg
$ 63.00
Chonluten 50mg
The Novera Compounds Advantage
Made in the USA
Manufactured in the United States under controlled standards. Reliable production. Dependable supply. No overseas uncertainty.
High Purity — 99% or Better
Every batch meets ≥99% purity specifications and is verified by independent third-party laboratory testing. Clean. Consistent. Documented.
Advanced Lyophilized Stability
Carefully lyophilized for structural integrity and easier handling. No cold shipping required. No dry ice. No complications.
Designed for Research
Ideal for scientific study, analytical testing, and research workflows where consistency and quality matter most.
Smart Pricing. Real Value.
High purity. USA-made. Third-party tested. Priced to make sense.
Everything in One Order
Already ordering other products? Add peptides to the same shipment. One vendor. One contact person. Simple.
Product Description
Specifications
Description
Strength: 10mg
CAS: 2460055-10-9
Chemical Formula: C₂₂₈H₃₈₈N₈₆O₆₄
Molecular weight: 5358.05 g/mol
Peptide Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
Synonyms: FOXO4-DRI
Storage: Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.
Shelf life: 24 months from the manufacturing date.
FOXO4 — About This Product
FOXO4 peptide is a synthetic version of the FOXO4 protein, which plays a role in managing cellular stress and longevity. It is made up of 46 amino acids in the D-form (the mirror image of natural amino acids) with a molecular weight of approximately 5.4 kDa (5,358 Da). This peptide is supplied as a lyophilized powder in a 10 mg vial, with a purity of ≥98%.
The FOXO4 peptide has been studied for its potential to regulate cellular senescence, DNA repair, and oxidative stress. Researchers use this peptide in laboratory settings to explore its role in aging, stress responses, and cell regeneration.
FOXO4 — Key Features and Benefits
-
High Purity: ≥98% purity, verified for reliable results.
-
Convenient Format: Lyophilized powder, provided in a 10 mg vial for easy reconstitution.
-
Research Focus: Investigated for its role in aging, oxidative stress, and DNA repair.
-
Laboratory-Ready: Suitable for in vitro and ex-vivo studies, compatible with various research protocols.
FOXO4 — Mechanism & Research Applications
Experts use FOXO4 for research to study how it influences cellular processes related to aging, stress adaptation, and DNA repair. Researchers focus on its potential role in cell regeneration and senescence (when damaged cells stop dividing), which could help understand aging and tissue health.
It has also been studied for its impact on oxidative stress and metabolic functions, particularly in how cells respond to damage. However, the findings are currently based on preclinical research, and human clinical trials are not available.
FOXO4 — Dosing & Observed Effects in Research
No clinical trials have been conducted for the FOXO4 peptide, so safe and effective human dosing has not been established. In preclinical research, doses ranged from 5–10 mg/kg body weight administered intravenously over a period of 5 days. In cell-based studies, typical concentrations used were 5–25 µM, but these do not translate to human dosing.
In animal models, FOXO4 can influence cellular behavior and stress-response pathways, though these findings are from research settings and do not imply therapeutic outcomes.
FOXO4 — Storage, Safety & References
-
Storage: Store FOXO4 peptide lyophilized at –20°C, away from light and moisture.
-
Reconstitution: After reconstitution with sterile, pyrogen-free solvent, store at 2–8°C and use within 5–7 days.
-
Handling: Use aseptic techniques and wear PPE (gloves, lab coat) during preparation and experimentation.
-
Safety: Avoid freeze-thaw cycles to preserve peptide integrity. Dispose of unused material according to local regulations.
References
https://pmc.ncbi.nlm.nih.gov/articles/PMC5556182/
https://pmc.ncbi.nlm.nih.gov/articles/PMC8116695/
https://pmc.ncbi.nlm.nih.gov/articles/PMC7053614/
https://www.nature.com/articles/s41467-019-13931-7
https://onlinelibrary.wiley.com/doi/10.1111/jcmm.17333
Compliance Notice
This product is intended for laboratory research use only and is not approved for human or veterinary use.




Reviews
There are no reviews yet.