You must be logged in to post a review.
Cagrilintide 10mg
Strength: 10mg
CAS: 1415456-99-3
Chemical Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
Molecular weight: 4408.258 g/mol
Peptide Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Synonyms: NN0174-0833, AM833, EX-A10092
Storage: Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.
Shelf life: 24 months from the manufacturing date.
Cagrilintide is a long-acting amylin receptor agonist examined in metabolic and appetite-regulation research. Research suggests it influences satiety and gastric emptying through amylin receptor signaling, supporting studies of appetite control and energy regulation. It is commonly studied to better understand how amylin-related pathways interact with broader neuroendocrine and metabolic signaling systems.
Disclaimer : Available as lyophilized (freeze-dried) powder for laboratory and in vitro research applications. Reconstitution solution is not included in the pack.
Purity ≥99%
Made in USA
Research Use Only
Fast Shipping
Explore Other High-Purity Peptides
Thymagen (Thymogen) 50mg
Tirzepatide 120mg
The Novera Compounds Advantage
Made in the USA
Manufactured in the United States under controlled standards. Reliable production. Dependable supply. No overseas uncertainty.
High Purity — 99% or Better
Every batch meets ≥99% purity specifications and is verified by independent third-party laboratory testing. Clean. Consistent. Documented.
Advanced Lyophilized Stability
Carefully lyophilized for structural integrity and easier handling. No cold shipping required. No dry ice. No complications.
Designed for Research
Ideal for scientific study, analytical testing, and research workflows where consistency and quality matter most.
Smart Pricing. Real Value.
High purity. USA-made. Third-party tested. Priced to make sense.
Everything in One Order
Already ordering other products? Add peptides to the same shipment. One vendor. One contact person. Simple.
Product Description
Specifications
Description
Strength: 10mg
CAS: 1415456-99-3
Chemical Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
Molecular weight: 4408.258 g/mol
Peptide Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Synonyms: NN0174-0833, AM833, EX-A10092
Storage: Store 2–8 °C (≤–20 °C long-term). RT exposure during transport acceptable. Protect from light.
Shelf life: 24 months from the manufacturing date.
Cagrilintide (10mg) About This Product
Cagrilintide (10 mg) is a synthetic peptide developed as a long-acting analogue of the naturally occurring hormone amylin. The cagrilintide peptide has a molecular weight of 4409.01 Da and CAS Number 1415456-99-3. It has been examined in laboratory and clinical research models related to metabolic regulation, energy balance, and feeding behavior.
Cagrilintide contains N-terminal acylation with a C20 fatty diacid (eicosanedioic acid) linked via a γ-glutamic acid spacer, along with an intramolecular disulfide bond between Cys3 and Cys8. These structural features improve peptide stability, extend half-life, and reduce amyloid fibril formation relative to native amylin, supporting sustained activity in experimental systems.
This product is supplied as a sterile, lyophilized powder manufactured at ≥99% purity, verified by reverse-phase HPLC, and packaged in a sealed research-grade vial. Laboratories that buy cagrilintide peptide commonly use this format for comparative peptide research, pharmacokinetic modeling, and metabolic signaling studies.
Cagrilintide (10mg) Key Features and Benefits
- Synthetic Amylin Analogue: Studied in metabolic and endocrine research models
- Dual Amylin and Calcitonin Receptor Agonist: With extended activity profile
- High Purity (≥99%): Verified by reverse-phase HPLC
- White to Off-White Lyophilized Powder: Reconstitutes in aqueous buffers
(solubility ≥50 mg/mL at 25 °C; gentle sonication may aid dissolution) - Defined Molecular Weight: 4408.258 g/mol Da
- CAS Number: 1415456-99-3
- Sealed Research Vials: These support traceability and reproducibility
Cagrilintide (10mg) Mechanism & Research Applications
Cagrilintide functions as a dual agonist of amylin and calcitonin receptors. Through activation of both receptor classes, cagrilintide has been shown in research models to promote satiety, delay gastric emptying, reduce post-prandial glucagon secretion, and support energy homeostasis. This dual-receptor activity distinguishes cagrilintide from single-receptor agonists examined in metabolic research.
Specific Mechanistic Effects
Laboratory studies have documented cagrilintide-associated effects, including:
- Satiety-promoting signaling linked to reduced food intake
- Delayed gastric emptying, reflected by slowed gastric transit
- Reduced post-prandial glucagon secretion
- Enhanced regulation of energy balance
- Modulation of hypothalamic appetite centers and feeding-behavior circuits
These effects arise from activation of the amylin and calcitonin receptors in appetite-regulating brain regions and peripheral metabolic tissues.
Research Applications
Cagrilintide has been employed in the following laboratory research contexts:
- Obesity and Metabolic Research: In vitro assays and rodent models examining amylin-receptor pharmacology, energy homeostasis, and adipose tissue signaling
- Glycemic Control Models: Studies of post-prandial glucose dynamics and glucagon secretion in pancreatic islet and hepatocyte systems
- Combination-Peptide Research: Exploratory studies assessing synergistic or comparative effects with incretin peptides, including GLP-1 receptor agonists
- Feeding-Behavior Studies: Assessment of meal patterns, appetite-related hormones, and hypothalamic gene expression in controlled feeding assays
- Pharmacokinetics and Formulation Development: Analytical validation of extended half-life, peptide stability, and delivery-vehicle performance
Institutions that order cagrilintide peptide commonly use it for mechanistic and comparative research rather than therapeutic evaluation.
Cagrilintide (10mg) Dosing & Observed Effects in Research
Published research reports microgram- to low-milligram-range dosing, with administration schedules tailored to experimental design, species, and study duration. No standardized dosing protocols exist outside research settings.
Observed outcomes are described as biological, pharmacodynamic, or pharmacokinetic responses, measured under controlled laboratory conditions. All findings remain model-specific and non-clinical.
Cagrilintide (10mg) Storage, Safety & References
Store Cagrilintide (10 mg) as a lyophilized powder at −20 °C, protected from light and moisture, to maintain stability for ≥2 years. For short-term research use of up to 6 months, storage at 2–8 °C is acceptable.
- Reconstitution Considerations: Due to N-terminal lipidation, complete dissolution may require gentle vortexing or brief sonication. Peptide concentration should be verified after reconstitution using appropriate analytical methods. Avoid repeated freeze–thaw cycles.
References
https://www.nature.com/articles/s41467-025-58680-y
https://pmc.ncbi.nlm.nih.gov/articles/PMC11642503/
https://pubmed.ncbi.nlm.nih.gov/40609154/
https://pubmed.ncbi.nlm.nih.gov/34798060/
https://pubs.acs.org/doi/10.1021/acs.jmedchem.1c00565
Compliance Notice
This product is intended for laboratory research use only and is not approved for human or veterinary use.




Reviews
There are no reviews yet.